PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G132000.1.p
Common NameGLYMA_15G132000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 714aa    MW: 80028.4 Da    PI: 6.7857
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G132000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox52.96.4e-172779456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                           ++t+ q+ +Le++ + +++p++++r++LA+++gL+++qVk+WFqN+R++ k
  Glyma.15G132000.1.p 27 YKRLTSAQTARLERFIKDCPHPDEAQRRQLASEIGLETKQVKFWFQNKRTQIK 79
                         56799********************************************9988 PP

2START133.91.8e-422274482205
                          HHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                START   2 laeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                          +a +a++elv+++  +ep W kss      +++ + + + f+++++      ++ea ++sg+v  ++ +lv  +ld+  +W + ++    
  Glyma.15G132000.1.p 227 VAASAMEELVRLIRINEPCWIKSStqdgqLILQHENYEKMFPRTNNfkgvnLRVEATKDSGIVSINSIQLVDMFLDSD-KWINLFPtivt 315
                          6889********************8887744555555555555555788999**************************.99888888888 PP

                          EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
                START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                          ka+t++v+++g      galqlm+ ++ +lsplv  R+f f+Ry++q ++g+wvi+dvS ds ++++   s+  + ++pSg++i++++ng
  Glyma.15G132000.1.p 316 KAKTIKVLENGlvgsrsGALQLMFEQMHVLSPLVQpREFQFLRYCEQIEEGVWVIADVSFDSFRQKT---SFFHSWRHPSGCMIQEMPNG 402
                          ********************************9977*********************9999999987...79****************** PP

                          EEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                START 161 hskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqce 205
                           s vtwvehv++++++  h+l++ l+++g+a g+ +w   lqr +e
  Glyma.15G132000.1.p 403 CSMVTWVEHVEVDDKIQtHQLYKDLIGTGIAYGTERWIMELQRIGE 448
                          ***************999********************99999776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-17679IPR009057Homeodomain-like
SuperFamilySSF466897.52E-162085IPR009057Homeodomain-like
PROSITE profilePS5007115.6942181IPR001356Homeobox domain
SMARTSM003894.0E-162385IPR001356Homeobox domain
CDDcd000861.87E-152382No hitNo description
PfamPF000461.5E-142779IPR001356Homeobox domain
PROSITE patternPS0002705679IPR017970Homeobox, conserved site
PROSITE profilePS5084842.834217452IPR002913START domain
SuperFamilySSF559618.38E-31220450No hitNo description
CDDcd088751.09E-98221445No hitNo description
SMARTSM002342.2E-30226449IPR002913START domain
PfamPF018521.7E-35227448IPR002913START domain
Gene3DG3DSA:3.30.530.205.7E-9245414IPR023393START-like domain
SuperFamilySSF559612.2E-11472673No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 714 aa     Download sequence    Send to blast
MDSSMASVGG SGDEGSDNFN QGRRPSYKRL TSAQTARLER FIKDCPHPDE AQRRQLASEI  60
GLETKQVKFW FQNKRTQIKN QHERADNTAL RVENDRIHSK NLLMKKALKN MLCPSCGGAP  120
CQDDREHLMQ KMQHENSRLK EEHEKVSSLL ARYLEKQMSP PEFQQVFNIP IIGSSSHAPK  180
LENSSLNYEI GGSSSHGPSL YGMQIMDGHD HNLMGSEGIE KTLMLKVAAS AMEELVRLIR  240
INEPCWIKSS TQDGQLILQH ENYEKMFPRT NNFKGVNLRV EATKDSGIVS INSIQLVDMF  300
LDSDKWINLF PTIVTKAKTI KVLENGLVGS RSGALQLMFE QMHVLSPLVQ PREFQFLRYC  360
EQIEEGVWVI ADVSFDSFRQ KTSFFHSWRH PSGCMIQEMP NGCSMVTWVE HVEVDDKIQT  420
HQLYKDLIGT GIAYGTERWI MELQRIGERF ACFYVERIPI QDSGGVINSL EGRRSVMNFC  480
HRMIKVFCES LTMSGNLDFP LLKMENNSGV RVSIRKNRNH LGQPKGVIVV AATSIWLPLH  540
YMKVFEFLTD DRRRAQWDVL CCGNNANKVA HISNGIHPGN CISISRPFIP SENNALILQE  600
SFTTPMGSYV VYAPTDVASM ISAINGEDSS MLPVLPSGFV ISADGEPNAA LEAFNSSDIE  660
RLGGSLLTVA FQILASSPDG INMPNMESVA AVNSLLTSTI LKVKDALNCN NLE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006586853.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
TrEMBLI1MG590.0I1MG59_SOYBN; Uncharacterized protein
STRINGGLYMA15G13950.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF10263398
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11